AibGenesis™ Mouse Anti-ak4 Antibody (MO-AB-00037R)


Cat: MO-AB-00037R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00037R Monoclonal Medaka (Oryzias latipes), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO00037R 100 µg
CBMOAB-35399FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO35399FYA 100 µg
CBMOAB-65347FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65347FYA 100 µg
MO-AB-08077W Monoclonal Cat (Felis catus) WB, ELISA MO08077W 100 µg
MO-AB-13654W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13654W 100 µg
MO-AB-34357W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34357W 100 µg
MO-AB-38437W Monoclonal Gorilla WB, ELISA MO38437W 100 µg
MO-AB-43617W Monoclonal Horse (Equus caballus) WB, ELISA MO43617W 100 µg
MO-AB-50641W Monoclonal Marmoset WB, ELISA MO50641W 100 µg
MO-AB-24016H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24016C 100 µg
MO-AB-32818H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32818C 100 µg
MO-AB-00029L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00029L 100 µg
MO-AB-00098Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00098Y 100 µg
MO-AB-07134Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07134Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO00037R
SpecificityThis antibody binds to Medaka ak4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1. (From NCBI)
Product OverviewThis product is a mouse antibody against ak4. It can be used for ak4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTP:AMP phosphotransferase AK3, mitochondrial; EC 2.7.4.10; Adenylate kinase 3; LOC101175146; ak3
UniProt IDH2M295
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MAKLFRAAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHVVTGLVLPKLEQLSSHSWLLDGFPRTLAQALVLNNVYQLDLVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEALMSRLRQYKEVAKPVIDLYKTQGILHSFSGTETNKIWPYINSLLSTKLNRQPSDAHQTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry