AibGenesis™ Mouse Anti-ak6 Antibody (MO-AB-01321H)
Cat: MO-AB-01321H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01321H | Monoclonal | Frog (Xenopus laevis), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO01321C | 100 µg | ||
| CBMOAB-1984FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO1984FC | 100 µg | ||
| CBMOAB-00778FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO00778FYA | 100 µg | ||
| CBMOAB-65350FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO65350FYA | 100 µg | ||
| MO-AB-38438W | Monoclonal | Gorilla | WB, ELISA | MO38438W | 100 µg | ||
| MO-AB-41204W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41204W | 100 µg | ||
| MO-AB-50644W | Monoclonal | Marmoset | WB, ELISA | MO50644W | 100 µg | ||
| MO-AB-07178R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07178R | 100 µg | ||
| MO-AB-00038R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00038R | 100 µg | ||
| MO-AB-24018H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24018C | 100 µg | ||
| MO-AB-32819H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32819C | 100 µg | ||
| MO-AB-00030L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00030L | 100 µg | ||
| MO-AB-07136Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07136Y | 100 µg | ||
| MO-AB-14150Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14150Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Frog (Xenopus laevis), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO01321C |
| Specificity | This antibody binds to Frog ak6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that belongs to the adenylate kinase family of enzymes. The protein has a nuclear localization and contains Walker A (P-loop) and Walker B motifs and a metal-coordinating residue. The protein may be involved in regulation of Cajal body formation. In human, AK6 and TAF9 (GeneID: 6880) are two distinct genes that share 5' exons. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | This product is a mouse antibody against ak6. It can be used for ak6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenylate kinase isoenzyme 6; AK6; EC 2.7.4.3; Coilin-interacting nuclear ATPase protein; Dual activity adenylate kinase/ATPase; AK6; ak6 cinap MGC115514 taf9 |
| UniProt ID | Q4QQY8 |
| Protein Refseq | The length of the protein is 171 amino acids long. The sequence is show below: MRSPNILLTGTPGVGKTTLGKELSSRTGLTYINVGDLAKEGNLYEGYDEEYDCPILDEDRVVDELEDKMSDGGVIVDYHGCEFFPERWFNIVFVLRTDNSLLYQRLESRGYKEKKLQDNIQCEIFQTIYEEAAESYQKDIVHQLPSNTPEDLEQNIEQITQWIQQWLKDNN. |
See other products for " AK6 "
| MO-AB-00099Y | AibGenesis™ Mouse Anti-AK6 Antibody (MO-AB-00099Y) |
| MO-AB-10616Y | AibGenesis™ Mouse Anti-AK6 Antibody (MO-AB-10616Y) |
| MO-AB-19963W | AibGenesis™ Mouse Anti-AK6 Antibody (MO-AB-19963W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry