AibGenesis™ Mouse Anti-AKAP10 Antibody (CBMOAB-35403FYA)


Cat: CBMOAB-35403FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35403FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO35403FYA 100 µg
CBMOAB-65364FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO65364FYA 100 µg
MO-AB-01324H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01324C 100 µg
MO-AB-07181R Monoclonal Cattle (Bos taurus) WB, ELISA MO07181R 100 µg
MO-AB-22582W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22582W 100 µg
MO-AB-50648W Monoclonal Marmoset WB, ELISA MO50648W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO35403FYA
SpecificityThis antibody binds to Rhesus AKAP10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins bind to the regulatory subunits of protein kinase A (PKA) and confine the holoenzyme to discrete locations within the cell. The encoded protein is localized to mitochondria and interacts with both the type I and type II regulatory subunits of PKA. Polymorphisms in this gene may be associated with increased risk of arrhythmias and sudden cardiac death. (From NCBI)
Product OverviewMouse Anti-Rhesus AKAP10 Antibody is a mouse antibody against AKAP10. It can be used for AKAP10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAKAP10
UniProt IDF6WRT6
Protein RefseqThe length of the protein is 583 amino acids long.
The sequence is show below: MDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKQHETTAAFLTDSLDKRLEDSGSAQLFMTHSEGIELNNRTNSTQNHLLLSQEYDSAHSLHLERARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSMTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVKKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAQYDQPLEKSTKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry