AibGenesis™ Mouse Anti-alkbh6 Antibody (CBMOAB-65571FYA)


Cat: CBMOAB-65571FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-65571FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO65571FYA 100 µg
MO-AB-01015W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01015W 100 µg
MO-AB-24039H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24039C 100 µg
MO-AB-50746W Monoclonal Marmoset WB, ELISA MO50746W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO65571FYA
SpecificityThis antibody binds to Zebrafish alkbh6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish alkbh6 Antibody is a mouse antibody against alkbh6. It can be used for alkbh6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-ketoglutarate-dependent dioxygenase alkB homolog 6; EC 1.14.11.-; Alkylated DNA repair protein alkB homolog 6; alkbh
UniProt IDQ6IQE9
Protein RefseqThe length of the protein is 234 amino acids long.
The sequence is show below: MANLCKRVVDLEKYIVKEAPPTVYYIPDFISEAEEEFLLQQVYRAPKPKWTQLSGRRLQNWGGLPNPKGMLAEKLPDWLLEYTEKISALGAFAGKTANHVLVNEYKPGEGIMPHEDGPLYHPTVTTITVGSHTLLDFYRPVCQAEPDAPQTEESRYMLSLLVQRKSLLILQDDMYKCYLHGIRGVCEDVLSEHVVNISSTGAQVGDTLPRSTRVSLTIRHVPKIIRANLFLGKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry