AibGenesis™ Mouse Anti-ANKMY2 Antibody (MO-AB-07354R)


Cat: MO-AB-07354R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07354R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07354R 100 µg
MO-AB-26063W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26063W 100 µg
MO-AB-50867W Monoclonal Marmoset WB, ELISA MO50867W 100 µg
MO-AB-00133Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00133Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07354R
SpecificityThis antibody binds to Cattle ANKMY2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ANKMY2 Antibody is a mouse antibody against ANKMY2. It can be used for ANKMY2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat and MYND domain-containing protein 2; ANKMY2
UniProt IDQ0VCS9
Protein RefseqThe length of the protein is 442 amino acids long.
The sequence is show below: MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLGSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGADVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPREKLDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLINENPLLAEEAALNKCYKVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKCINFLKDRENKLDTLIKSLLKGRA.
For Research Use Only | Not For Clinical Use.
Online Inquiry