AibGenesis™ Mouse Anti-ANKRD34A Antibody (CBMOAB-35749FYA)


Cat: CBMOAB-35749FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35749FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO35749FYA 100 µg
MO-AB-19861W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19861W 100 µg
MO-AB-50885W Monoclonal Marmoset WB, ELISA MO50885W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO35749FYA
SpecificityThis antibody binds to Rhesus ANKRD34A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ANKRD34A Antibody is a mouse antibody against ANKRD34A. It can be used for ANKRD34A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesANKRD34A
UniProt IDF6PTQ2
Protein RefseqThe length of the protein is 149 amino acids long.
The sequence is show below: TPAAAMLHTEGHALLRAVGQGKLRLARLLLEGGAYVNEGDAQGETALMAACRARYDDPQNKARMVRYLLEQGADPNIADRLGRTALMHACAGGGGAAVASLLLAHGANPSVRDHAGASALVHALDRGDRETLATLLDACNAKGTEVIII.
For Research Use Only | Not For Clinical Use.
Online Inquiry