AibGenesis™ Mouse Anti-ANOS1 Antibody (MO-AB-07390R)


Cat: MO-AB-07390R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07390R Monoclonal Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO07390R 100 µg
MO-AB-24077H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24077C 100 µg
MO-AB-50931W Monoclonal Marmoset WB, ELISA MO50931W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO07390R
SpecificityThis antibody binds to Cattle ANOS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ANOS1 Antibody is a mouse antibody against ANOS1. It can be used for ANOS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKAL1 protein; KAL1; LOC525898
UniProt IDA2VE88
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: MAAGAPGAALTLCLWLAASAGCLAAGSGAAAARRLDESLAAGSVQRARCASRCLSLQITRISAFFQHFQNNGSLVWCQNHKQCSKCLEPCKVSWDLRKQQCQSFCESLFPKKNYECVTSCEFLKYILSVKQGDCPSPEKASGFAAACVESCDADDECSGVKKCCSNGCGHTCQVPKTLYKGEEQGRAGVKGPAASQRLVCARGRGCQSKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry