Rabbit Anti-Antp Antibody (MO-DKB-00546W)


Cat: MO-DKB-00546W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesRabbit (Oryctolagus cuniculus)
Species ReactivityFruit fly (Drosophila melanogaster)
ImmunogenA synthetic peptide corresponding to the Drosophila region. Peptide sequence QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
FormatLiquid or Lyophilized
BufferPBS, 2% sucrose
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
PurityAffinity purified

Application Information

ApplicationWB
Application NotesWestern Blot 1.0 ug/ml

Target

IntroductionAntennapedia (Antp) is the most distal member of the Antennapedia complex; one of two Hox gene complexes. Antp encodes a sequence-specific homeodomain transcription factor, which is part of a developmental regulatory system that specifies the segmental identity of the prothorax and mid-thorax. In adults, the loss of Antp function is related to the transformation of the legs to the antennae, and the ectopic expression of the head is related to the transformation of the antennae to the legs and the eyes to the wings.
Product OverviewThis product is a Rabbit antibody against the Antp. It can be used for Antp detection in Western Blot.
Alternative NamesAntennapedia, isoform J; Antennapedia, isoform L; Antennapedia, isoform M; Antp
UniProt IDA4V2I6
See other products for " Antp "
MO-NAB-00697WMouse Anti-Antp Antibody
MO-NAB-00696WMouse Anti-Antp Antibody
CBMOAB-01052FYAMouse Anti-D. melanogaster Antp Antibody (CBMOAB-01052FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry