Mouse Anti-D. melanogaster Antp Antibody (CBMOAB-01052FYA)


Cat: CBMOAB-01052FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO01052FYA
SpecificityThis antibody binds to fruit fly Antp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAntennapedia (Antp) is the most distal member of the Antennapedia complex; one of two Hox gene complexes. Antp encodes a sequence-specific homeodomain transcription factor, which is part of a developmental regulatory system that specifies the segmental identity of the prothorax and mid-thorax. In adults, the loss of Antp function is related to the transformation of the legs to the antennae, and the ectopic expression of the head is related to the transformation of the antennae to the legs and the eyes to the wings.
Product OverviewMouse Anti-D. melanogaster Antp Antibody is a mouse antibody against Antp. It can be used for Antp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAntennapedia, isoform J; Antennapedia, isoform L; Antennapedia, isoform M; Antp
UniProt IDA4V2I6
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ.
See other products for " Antp "
For Research Use Only | Not For Clinical Use.
Online Inquiry