AibGenesis™ Mouse Anti-AP1S3 Antibody (CBMOAB-35927FYA)


Cat: CBMOAB-35927FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35927FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO35927FYA 100 µg
MO-AB-07437R Monoclonal Cattle (Bos taurus) WB, ELISA MO07437R 100 µg
MO-AB-24086H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24086C 100 µg
MO-AB-50999W Monoclonal Marmoset WB, ELISA MO50999W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO35927FYA
SpecificityThis antibody binds to Rhesus AP1S3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adaptor-related protein complex 1, sigma subunit genes. The encoded protein is a component of adaptor protein complex 1 (AP-1), one of the AP complexes involved in claathrin-mediated vesicular transport from the Golgi or endosomes. Disruption of the pathway for display of HIV-1 antigens, which prevents recognition of the virus by cytotoxic T cells, has been shown to involve the AP-1 complex (PMID: 15569716). Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus AP1S3 Antibody is a mouse antibody against AP1S3. It can be used for AP1S3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP1S3
UniProt IDF7A390
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: IHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYKRYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIGGEIQETSKKIAVKAIEDSDMLQENHLNPEGRGCSEPRFCHCTPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry