AibGenesis™ Mouse Anti-AP4S1 Antibody (CBMOAB-35951FYA)


Cat: CBMOAB-35951FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35951FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35951FYA 100 µg
CBMOAB-66073FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66073FYA 100 µg
MO-AB-01473H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01473C 100 µg
MO-AB-07456R Monoclonal Cattle (Bos taurus) WB, ELISA MO07456R 100 µg
MO-AB-18810W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18810W 100 µg
MO-AB-24094H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24094C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35951FYA
SpecificityThis antibody binds to Rhesus AP4S1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the adaptor complexes small subunit protein family. These proteins are components of the heterotetrameric adaptor protein complexes, which play important roles in the secretory and endocytic pathways by mediating vesicle formation and sorting of integral membrane proteins. The encoded protein is the small subunit of adaptor protein complex-4, which is associated with both clathrin- and nonclathrin-coated vesicles. Mutations in this gene are associated with spastic quadriplegic cerebral palsy-6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6. (From NCBI)
Product OverviewMouse Anti-Rhesus AP4S1 Antibody is a mouse antibody against AP4S1. It can be used for AP4S1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP4S1
UniProt IDF7GAN4
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MIKFFLMVNKQGQTQLCKYYEHVDINKRTLLETEVIKSCLSRSNEQCPFTEYKDFRLIYRQCAALFIVVGVDDTETEMAIYEFIHNFVEVLDEYFSRVSELDKMFNLDKVHIILDETVLNGCVVETNRERILAPLLILYVRKLKGSIFQTTWIYRKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry