AibGenesis™ Mouse Anti-APY2 Antibody (CBMOAB-18637FYB)


Cat: CBMOAB-18637FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18637FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula) WB, ELISA MO18637FYB 100 µg
CBMOAB-2374FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2374FC 100 µg
MO-AB-00033W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00033W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula)
CloneMO18637FYB
SpecificityThis antibody binds to Rice APY2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice APY2 Antibody is a mouse antibody against APY2. It can be used for APY2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable apyrase 2; OsAPY2; EC 3.6.1.5; ATP-diphosphatase; ATP-diphosphohydrolase; Adenosine diphosphatase; ADPase; APY2; Os07g0682800 LOC_Os07g48430
UniProt IDQ6Z4P2
Protein RefseqThe length of the protein is 467 amino acids long.
The sequence is show below: MRRYSALPGGGARPDTLADRLHRYRGVLLVILAPLALVSLVLLLMPRSPASSSAAAGRRWGPLDANKYAVIFDAGSSGSRVHVFRFDANLDLLHIGDQIELFVQKKPGLSEYANNPQEAAKSLVSLLEDAKRVVPVELRGQTPVRVGATAGLRALGAEKSEEILQAVRDLLREKSSFKTQPDWVTVLDGPQEGAYEWVTINYLLGKLGKTYADTVGVVDLGGGSVQMAYAIAEKDAVKAPKPSEGEDSYVKKLFLKGTTYYLYVHSYLHYGLLAARAEILKAGNGKGYSYCTLEGHQGQYKYGNGKFEASASPSGASYSKCRDDVVKALKVDQACTHMKCSFGGIWNGGGGAGQKNLFVASFFFDRAAEAGFVNPKAPVAKVKPSDFEKAAKRACKLNLKDAEAAYPGVQKDNIPYICMDLVYQYTLLVDGFGVGSHQEMTLVKKVPYSNAFVEAAWPLGSAIEVAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry