Mouse Anti-Arabidopsis ACBP6 Antibody (CBMOAB-1418FYC)
Cat: CBMOAB-1418FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO1418FC |
| Specificity | This antibody binds to Arabidopsis ACBP6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Cytosol; Plasma Membrane; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl-CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism. |
| Product Overview | Mouse Anti-Arabidopsis ACBP6 Antibody is a mouse antibody against ACBP6. It can be used for ACBP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Acyl-CoA-binding domain-containing protein 6; Acyl-CoA binding protein 6; Acyl-CoA-binding protein; ACBP; ACBP6; At1g31812 |
| UniProt ID | P57752 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAASKAST. |
See other products for " ACBP6 "
| MO-DKB-02114W | Rabbit Anti-ACBP6 Antibody (MO-DKB-02114W) |
| CBMOAB-00232HCB | Mouse Anti-C. elegans ACBP6 Antibody (CBMOAB-00232HCB) |
| MO-AB-02070W | Mouse Anti-Fruit fly Acbp6 Antibody (MO-AB-02070W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry