Mouse Anti-Fruit fly Acbp6 Antibody (MO-AB-02070W)


Cat: MO-AB-02070W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02070W
SpecificityThis antibody binds to Fruit fly Acbp6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBinds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl-CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism.
Product OverviewMouse Anti-Fruit fly Acbp6 Antibody is a mouse antibody against Acbp6. It can be used for Acbp6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG15829, isoform A; CG15829, isoform B; Acbp6
UniProt IDQ9VS21
Protein RefseqThe length of the protein is 82 amino acids long.
The sequence is show below: MPTFEEIVEKAKNFKNLPSKEEFLEFYGYYKQATVGDCNIEEPEDEEKKARYNAWKSKAGLTADDAKAYYIEVYKKYAPQYE.
See other products for " ACBP6 "
CBMOAB-00232HCBMouse Anti-C. elegans ACBP6 Antibody (CBMOAB-00232HCB)
MO-DKB-02114WRabbit Anti-ACBP6 Antibody (MO-DKB-02114W)
CBMOAB-1418FYCMouse Anti-Arabidopsis ACBP6 Antibody (CBMOAB-1418FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry