Mouse Anti-Arabidopsis AK3 Antibody (CBMOAB-1980FYC)


Cat: CBMOAB-1980FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO1980FC
SpecificityThis antibody binds to Arabidopsis AK3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.
Product OverviewMouse Anti-Arabidopsis AK3 Antibody is a mouse antibody against AK3. It can be used for AK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate Kinase 3; Adenylate Kinase 3 Alpha-Like 1; EC 2.7.4.10; AK3L1; AKL3L; AK6; GTP:AMP Phosphotransferase AK3, Mitochondrial; Adenylate Kinase 6, Adenylate Kinase 3 Like 1
UniProt IDQ38990
Protein RefseqThe length of the protein is 57 amino acids long. The sequence is show below: KASNILLDADMIPKIADFGMARISGIDQSVANTKRIAGTFGYMPPEYVIHGQFSMES.
For Research Use Only | Not For Clinical Use.
Online Inquiry