Mouse Anti-Arabidopsis AK3 Antibody (CBMOAB-1980FYC)
Cat: CBMOAB-1980FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO1980FC |
Specificity | This antibody binds to Arabidopsis AK3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Arabidopsis AK3 Antibody is a mouse antibody against AK3. It can be used for AK3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenylate Kinase 3; Adenylate Kinase 3 Alpha-Like 1; EC 2.7.4.10; AK3L1; AKL3L; AK6; GTP:AMP Phosphotransferase AK3, Mitochondrial; Adenylate Kinase 6, Adenylate Kinase 3 Like 1 |
UniProt ID | Q38990 |
Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: KASNILLDADMIPKIADFGMARISGIDQSVANTKRIAGTFGYMPPEYVIHGQFSMES. |
See other products for " AK3 "
MO-AB-00036R | Mouse Anti-Medaka AK3 Antibody (MO-AB-00036R) |
MO-AB-23651R | Mouse Anti-Pig AK3 Antibody (MO-AB-23651R) |
MO-AB-07133Y | Mouse Anti-Rabbit AK3 Antibody (MO-AB-07133Y) |
MO-AB-26917W | Mouse Anti-Chimpanzee AK3 Antibody (MO-AB-26917W) |
MO-AB-08416W | Mouse Anti-Cat AK3 Antibody (MO-AB-08416W) |
MO-AB-10614Y | Mouse Anti-O. mykiss AK3 Antibody (MO-AB-10614Y) |
MO-AB-06274Y | Mouse Anti-O. anatinus AK3 Antibody (MO-AB-06274Y) |
MO-AB-42930W | Mouse Anti-Hamsters AK3 Antibody (MO-AB-42930W) |
MO-AB-01320H | Mouse Anti-Frog ak3 Antibody (MO-AB-01320H) |
MO-AB-17446W | Mouse Anti-Chimpanzee AK3 Antibody (MO-AB-17446W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry