Mouse Anti-Arabidopsis AP1M1 Antibody (CBMOAB-2236FYC)


Cat: CBMOAB-2236FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO2236FC
SpecificityThis antibody binds to Arabidopsis AP1M1.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.
Product OverviewMouse Anti-Arabidopsis AP1M1 (clone MO2236FC) Antibody (CBMOAB-2236FYC) is a mouse antibody against AP1M1. It can be used for AP1M1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdaptor Related Protein Complex 1 Mu 1 Subunit; Clathrin Assembly Protein Complex 1 Mu-1 Medium Chain 1; Adaptor-Related Protein Complex 1 Subunit Mu-1; Golgi Adaptor HA1/AP1 Adaptin Mu-1 Subunit; Adaptor Protein Complex AP-1 Subunit Mu-1; Clathrin Coat-Associated Protein AP47; Clathrin Coat Assembly Protein AP47; AP-Mu Chain Family Member Mu1A; Mu-Adaptin 1; Mu1A-Adaptin; CLTNM; Clathrin Assembly Protein Complex 1 Medium Chain 1; Clathrin Assembly Protein Complex 1, Medium Chain
UniProt IDQ9SAC9
Protein RefseqThe length of the protein is 428 amino acids long. The sequence is show below: MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIETEGDSQSNDPVAYDNGVTYMFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQFTEARILSEFIKTDAYRMEVTQRPPMAVTNSVSWRSEGLKFKKNEVFLDVIESVNILVNSNGQIVRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRAIKGKAIDLEDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAHIERHSRSRVEMLVKARSQFKDRSYATSVEIELPVPTDAYNPDVRTSLGSAAYAPEKDALVWKIQYFYGNKEHTLKADFHLPSIAAEEATPERKAPIRVKFEIPKFIVSGIQVRYLKIIEKSGYQAHPWVRYITMAGEYELRLM.
For Research Use Only | Not For Clinical Use.

Online Inquiry