Mouse Anti-Arabidopsis CLPP4 Antibody (CBMOAB-26250FYC)


Cat: CBMOAB-26250FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO26250FC
SpecificityThis antibody binds to Arabidopsis CLPP4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Essential protein required for chloroplast development and integrity (PubMed:16705403, PubMed:17241447). Essential for Embryogenesis (PubMed:23548781).
Product OverviewMouse Anti-Arabidopsis CLPP4 (clone MO26250FC) Antibody (CBMOAB-26250FYC) is a mouse antibody against CLPP4. It can be used for CLPP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-dependent Clp protease proteolytic subunit 4, chloroplastic; EC 3.4.21.92; Endopeptidase ClpP4; nClpP4; nClpP3; CLPP4; NCLPP3 NCLPP4; At5g45390
UniProt IDQ94B60
Protein RefseqThe length of the protein is 292 amino acids long. The sequence is show below: MGTLSLSSSLKPSLVSSRLNSSSSASSSSFPKPNNLYLKPTKLISPPLRTTSPSPLRFANASIEMSQTQESAIRGAESDVMGLLLRERIVFLGSSIDDFVADAIMSQLLLLDAKDPKKDIKLFINSPGGSLSATMAIYDVVQLVRADVSTIALGIAASTASIILGAGTKGKRFAMPNTRIMIHQPLGGASGQAIDVEIQAKEVMHNKNNVTSIIAGCTSRSFEQVLKDIDRDRYMSPIEAVEYGLIDGVIDGDSIIPLEPVPDRVKPRVNYEEISKDPMKFLTPEIPDDEIY.
For Research Use Only | Not For Clinical Use.

Online Inquiry