Mouse Anti-Arabidopsis LSM5 Antibody (CBMOAB-36025FYC)
Cat: CBMOAB-36025FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO36025FC |
Specificity | This antibody binds to Arabidopsis LSM5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of LSM protein complexes, which are involved in RNA processing. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by promoting decapping and leading to accurate 5'-3' mRNA decay. The cytoplasmic LSM1-LSM7 complex regulates developmental gene expression by the decapping of specific development-related transcripts. Component of the nuclear LSM2-LSM8 complex which is involved splicing nuclear mRNAs. LSM2-LSM8 binds directly to the U6 small nuclear RNAs (snRNAs) and is essential for accurate splicing of selected development-related mRNAs through the stabilization of the spliceosomal U6 snRNA. Plays a critical role in the regulation of development-related gene expression (PubMed:23221597, PubMed:23620288). Involved in the control of plant sensitivity to abscisic acid (ABA) and drought (PubMed:11740939). Functions with ABH1 as negative regulator of ABA signaling in guard cells (PubMed:12427994). Required for regulation of splicing efficiency of many stress-responsive genes under stress conditions (PubMed:24393432). |
Product Overview | Mouse Anti-Arabidopsis LSM5 Antibody is a mouse antibody against LSM5. It can be used for LSM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sm-like protein LSM5; AtLSM5; Protein SUPERSENSITIVE TO ABA AND DROUGHT 1; AtSAD1; U6 snRNA-associated Sm-like protein LSM5; LSM5; SAD1; At5g48870 |
UniProt ID | Q9FKB0 |
Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEITAEGRRVTKLDQILLNGNNIAILVPGGSPEDGE. |
See other products for " LSM5 "
CBMOAB-06192HCB | Mouse Anti-C. elegans LSM5 Antibody (CBMOAB-06192HCB) |
MO-AB-27792W | Mouse Anti-Cottonwood LSM5 Antibody (MO-AB-27792W) |
MO-AB-26859H | Mouse Anti-Rat Lsm5 Antibody (MO-AB-26859H) |
MO-AB-23383H | Mouse Anti-Mallard LSM5 Antibody (MO-AB-23383H) |
MO-AB-05992Y | Mouse Anti-A. aegpti LSM5 Antibody (MO-AB-05992Y) |
MO-AB-11992Y | Mouse Anti-O. mykiss LSM5 Antibody (MO-AB-11992Y) |
MO-AB-04184W | Mouse Anti-Rhesus LSM5 Antibody (MO-AB-04184W) |
CBMOAB-49300FYA | Mouse Anti-Rhesus LSM5 Antibody (CBMOAB-49300FYA) |
MO-AB-43244W | Mouse Anti-Hamsters LSM5 Antibody (MO-AB-43244W) |
MO-AB-15124R | Mouse Anti-Cattle LSM5 Antibody (MO-AB-15124R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry