Mouse Anti-Arabidopsis LSM5 Antibody (CBMOAB-36025FYC)
Cat: CBMOAB-36025FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO36025FC |
| Specificity | This antibody binds to Arabidopsis LSM5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of LSM protein complexes, which are involved in RNA processing. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by promoting decapping and leading to accurate 5'-3' mRNA decay. The cytoplasmic LSM1-LSM7 complex regulates developmental gene expression by the decapping of specific development-related transcripts. Component of the nuclear LSM2-LSM8 complex which is involved splicing nuclear mRNAs. LSM2-LSM8 binds directly to the U6 small nuclear RNAs (snRNAs) and is essential for accurate splicing of selected development-related mRNAs through the stabilization of the spliceosomal U6 snRNA. Plays a critical role in the regulation of development-related gene expression (PubMed:23221597, PubMed:23620288). Involved in the control of plant sensitivity to abscisic acid (ABA) and drought (PubMed:11740939). Functions with ABH1 as negative regulator of ABA signaling in guard cells (PubMed:12427994). Required for regulation of splicing efficiency of many stress-responsive genes under stress conditions (PubMed:24393432). |
| Product Overview | Mouse Anti-Arabidopsis LSM5 Antibody is a mouse antibody against LSM5. It can be used for LSM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Sm-like protein LSM5; AtLSM5; Protein SUPERSENSITIVE TO ABA AND DROUGHT 1; AtSAD1; U6 snRNA-associated Sm-like protein LSM5; LSM5; SAD1; At5g48870 |
| UniProt ID | Q9FKB0 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEITAEGRRVTKLDQILLNGNNIAILVPGGSPEDGE. |
See other products for " LSM5 "
| MO-AB-04184W | Mouse Anti-Rhesus LSM5 Antibody (MO-AB-04184W) |
| MO-AB-23383H | Mouse Anti-Mallard LSM5 Antibody (MO-AB-23383H) |
| MO-AB-10808W | Mouse Anti-Chimpanzee LSM5 Antibody (MO-AB-10808W) |
| MO-AB-11992Y | Mouse Anti-O. mykiss LSM5 Antibody (MO-AB-11992Y) |
| MO-AB-35070W | Mouse Anti-Ferret LSM5 Antibody (MO-AB-35070W) |
| CBMOAB-02109CR | Mouse Anti-Yeast LSM5 Antibody (CBMOAB-02109CR) |
| MO-AB-05992Y | Mouse Anti-A. aegpti LSM5 Antibody (MO-AB-05992Y) |
| CBMOAB-06192HCB | Mouse Anti-C. elegans LSM5 Antibody (CBMOAB-06192HCB) |
| MO-AB-13903Y | Mouse Anti-Sea-anemone LSM5 Antibody (MO-AB-13903Y) |
| MO-AB-26859H | Mouse Anti-Rat Lsm5 Antibody (MO-AB-26859H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry