Mouse Anti-Hamsters LSM5 Antibody (MO-AB-43244W)
Cat: MO-AB-43244W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Hamsters (Cricetinae) |
Clone | MO43244W |
Specificity | This antibody binds to Hamsters LSM5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. |
Product Overview | Mouse Anti-Hamsters LSM5 Antibody is a mouse antibody against LSM5. It can be used for LSM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | U6 snRNA-associated Sm-like protein LSm5; LSM5 |
UniProt ID | G3HMP6 |
Protein Refseq | The length of the protein is62 amino acids long. The sequence is show below: MKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV. |
See other products for " LSM5 "
CBMOAB-49300FYA | Mouse Anti-Rhesus LSM5 Antibody (CBMOAB-49300FYA) |
MO-AB-11992Y | Mouse Anti-O. mykiss LSM5 Antibody (MO-AB-11992Y) |
MO-AB-35070W | Mouse Anti-Ferret LSM5 Antibody (MO-AB-35070W) |
MO-AB-04184W | Mouse Anti-Rhesus LSM5 Antibody (MO-AB-04184W) |
MO-AB-15124R | Mouse Anti-Cattle LSM5 Antibody (MO-AB-15124R) |
MO-AB-27792W | Mouse Anti-Cottonwood LSM5 Antibody (MO-AB-27792W) |
MO-AB-13903Y | Mouse Anti-Sea-anemone LSM5 Antibody (MO-AB-13903Y) |
MO-AB-05992Y | Mouse Anti-A. aegpti LSM5 Antibody (MO-AB-05992Y) |
CBMOAB-36025FYC | Mouse Anti-Arabidopsis LSM5 Antibody (CBMOAB-36025FYC) |
MO-AB-26859H | Mouse Anti-Rat Lsm5 Antibody (MO-AB-26859H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry