Mouse Anti-Ferret LSM5 Antibody (MO-AB-35070W)
Cat: MO-AB-35070W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Ferret (Mustela Putorius Furo) |
| Clone | MO35070W |
| Specificity | This antibody binds to Ferret LSM5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. |
| Product Overview | Mouse Anti-Ferret LSM5 Antibody is a mouse antibody against LSM5. It can be used for LSM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | LSM5-like protein, U6 small nuclear RNA associated |
| UniProt ID | G9K8Y2 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: ELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV. |
See other products for " LSM5 "
| MO-AB-43244W | Mouse Anti-Hamsters LSM5 Antibody (MO-AB-43244W) |
| CBMOAB-36025FYC | Mouse Anti-Arabidopsis LSM5 Antibody (CBMOAB-36025FYC) |
| MO-AB-23383H | Mouse Anti-Mallard LSM5 Antibody (MO-AB-23383H) |
| MO-AB-15124R | Mouse Anti-Cattle LSM5 Antibody (MO-AB-15124R) |
| CBMOAB-02109CR | Mouse Anti-Yeast LSM5 Antibody (CBMOAB-02109CR) |
| MO-AB-13903Y | Mouse Anti-Sea-anemone LSM5 Antibody (MO-AB-13903Y) |
| MO-AB-27792W | Mouse Anti-Cottonwood LSM5 Antibody (MO-AB-27792W) |
| CBMOAB-06192HCB | Mouse Anti-C. elegans LSM5 Antibody (CBMOAB-06192HCB) |
| MO-AB-11992Y | Mouse Anti-O. mykiss LSM5 Antibody (MO-AB-11992Y) |
| MO-AB-04184W | Mouse Anti-Rhesus LSM5 Antibody (MO-AB-04184W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry