Mouse Anti-Yeast LSM5 Antibody (CBMOAB-02109CR)
Cat: CBMOAB-02109CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast |
Clone | MO02109CR |
Specificity | This antibody binds to Yeast LSM5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner. Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. Component of the nuclear LSM2-LSM8 complex, which is involved in splicing of nuclear mRNAs. LSM2-LSM8 associates with multiple snRNP complexes containing the U6 snRNA (U4/U6 snRNP, U4/U6.U5 snRNP, and free U6 snRNP). It binds directly to the U6 snRNA and plays a role in the biogenesis and stability of the U6 snRNP and U4/U6 snRNP complexes. It probably also is involved in degradation of nuclear pre-mRNA by targeting them for decapping. LSM5 binds specifically to the 3'-terminal U-tract of U6 snRNA. LSM2-LSM8 probably is involved in processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. LSM5, probably in a complex that contains LSM2-LSM7 but not LSM1 or LSM8, associates with the precursor of the RNA component of RNase P (pre-P RNA) and may be involved in maturing pre-P RNA. LSM5 is required for processing of pre-tRNAs, pre-rRNAs and U3 snoRNA. |
Product Overview | Mouse Anti-Yeast LSM5 Antibody is a mouse antibody against LSM5. It can be used for LSM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | U6 snRNA-associated Sm-like protein LSm5; LSM5; YER146W |
UniProt ID | P40089 |
Protein Refseq | The length of the protein is 93 amino acids long. The sequence is show below: MSLPEILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLIDPEDESRNEKVMQHHGRMLLSGNNIAILVPGGKKTPTEAL. |
See other products for " LSM5 "
CBMOAB-36025FYC | Mouse Anti-Arabidopsis LSM5 Antibody (CBMOAB-36025FYC) |
MO-AB-15124R | Mouse Anti-Cattle LSM5 Antibody (MO-AB-15124R) |
MO-AB-04184W | Mouse Anti-Rhesus LSM5 Antibody (MO-AB-04184W) |
CBMOAB-06192HCB | Mouse Anti-C. elegans LSM5 Antibody (CBMOAB-06192HCB) |
MO-AB-04931H | Mouse Anti-Frog lsm5 Antibody (MO-AB-04931H) |
MO-AB-43244W | Mouse Anti-Hamsters LSM5 Antibody (MO-AB-43244W) |
MO-AB-27792W | Mouse Anti-Cottonwood LSM5 Antibody (MO-AB-27792W) |
MO-AB-13903Y | Mouse Anti-Sea-anemone LSM5 Antibody (MO-AB-13903Y) |
MO-AB-26859H | Mouse Anti-Rat Lsm5 Antibody (MO-AB-26859H) |
MO-AB-11992Y | Mouse Anti-O. mykiss LSM5 Antibody (MO-AB-11992Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry