Mouse Anti-Arabidopsis RPS14 Antibody (CBMOAB-40637FYC)
Cat: CBMOAB-40637FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO40637FC |
| Specificity | This antibody binds to Arabidopsis RPS14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Product Overview | Mouse Anti-Arabidopsis RPS14 Antibody is a mouse antibody against RPS14. It can be used for RPS14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribosomal Protein S14; Small Ribosomal Subunit Protein US11; 40S Ribosomal Protein S14; Emetine Resistance; EMTB; S14 |
| UniProt ID | Q9SMX4 |
| Protein Refseq | The length of the protein is 164 amino acids long. The sequence is show below: MASLRRVLLNVTSYCQRSLTQSSYSTSGMLSRSVVKHANNLGQIQARHFTTTLMKSGPKHSGTEQGVKRNSADHRRRLLAARFELRRKLYKAFCKDPDLPSEMRDKNRYKLSKLPRNSAFARIRNRCVFTGRSRSVTELFRVSRIVFRGLASKGALMGITKSSW. |
See other products for " Rps14 "
| MO-AB-07438W | Mouse Anti-Cat Rps14 Antibody (MO-AB-07438W) |
| MO-AB-07281H | Mouse Anti-Frog rps14 Antibody (MO-AB-07281H) |
| MO-AB-19549R | Mouse Anti-Cattle RPS14 Antibody (MO-AB-19549R) |
| MO-AB-43406W | Mouse Anti-Hamsters RPS14 Antibody (MO-AB-43406W) |
| MO-AB-63563W | Mouse Anti-Marmoset RPS14 Antibody (MO-AB-63563W) |
| MO-AB-39482W | Mouse Anti-Grape rps14 Antibody (MO-AB-39482W) |
| MO-AB-33152W | Mouse Anti-Dog rpS14 Antibody (MO-AB-33152W) |
| MO-AB-30526H | Mouse Anti-Sugar beet rps14 Antibody (MO-AB-30526H) |
| MO-AB-32492H | Mouse Anti-Soybean rps14 Antibody (MO-AB-32492H) |
| CBMOAB-96510FYA | Mouse Anti-Zebrafish rps14 Antibody (CBMOAB-96510FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry