AibGenesis™ Mouse Anti-Araf Antibody (MO-AB-24133H)


Cat: MO-AB-24133H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24133H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO24133C 100 µg
CBMOAB-66273FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66273FYA 100 µg
MO-AB-16552W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16552W 100 µg
MO-AB-34403W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34403W 100 µg
MO-AB-51136W Monoclonal Marmoset WB, ELISA MO51136W 100 µg
MO-AB-07531R Monoclonal Cattle (Bos taurus) WB, ELISA MO07531R 100 µg
MO-AB-01524H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01524C 100 µg
MO-AB-14228Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14228Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO24133C
SpecificityThis antibody binds to Rat Araf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Araf. It can be used for Araf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRas-binding protein DA-Raf; V-raf murine sarcoma 3611 viral oncogene homolog; V-raf murine sarcoma 3611 viral oncogene homolog, isoform CRA_e; Araf
UniProt IDQ6P9W2
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: MEPPRGPPASGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEVPSNLSVNELLTPQGPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry