AibGenesis™ Mouse Anti-ARD4 Antibody (CBMOAB-18645FYB)


Cat: CBMOAB-18645FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18645FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO18645FYB 100 µg
CBMOAB-2416FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO2416FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO18645FYB
SpecificityThis antibody binds to Rice ARD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice ARD4 Antibody is a mouse antibody against ARD4. It can be used for ARD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 4 (EC 1.13.11.54) (Acireductone dioxygenase; Fe(2+)-requiring) 4; ARD 4; Fe-ARD 4; ARD4; Os10g0419500 LOC_Os10g28360
UniProt IDQ7XEJ5
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MAHLVWMLGENGEEKSFENPNELLPLSRLEEIGVLYWHLDPKKSESEEELTKIRRERGYSYFDLTEICPDKLENYEEKLKSFYCEHIHADEEIRYCLEGSGYFDVRDKDDKWIRIWIKEGDMIILPAGIYHRFIVDSNNYIKLMRLFIGEPVWTAYNRPQEDHPVRQEYVKNVKGDTGFALAAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry