AibGenesis™ Mouse Anti-ARGLU1 Antibody (CBMOAB-36133FYA)


Cat: CBMOAB-36133FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36133FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO36133FYA 100 µg
MO-AB-07553R Monoclonal Cattle (Bos taurus) WB, ELISA MO07553R 100 µg
MO-AB-18286W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18286W 100 µg
MO-AB-51170W Monoclonal Marmoset WB, ELISA MO51170W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO36133FYA
SpecificityThis antibody binds to Rhesus ARGLU1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for the estrogen-dependent expression of ESR1 target genes. Can act in cooperation with MED1. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus ARGLU1 Antibody is a mouse antibody against ARGLU1. It can be used for ARGLU1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARGLU1
UniProt IDF7HNY0
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MKLNEKFSEGWRKPNASWKSSCSKNSSDRDKLSLQHKKLERGSWRVWQPRSTLCRTLDKTEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry