AibGenesis™ Mouse Anti-ARHGAP15 Antibody (CBMOAB-36140FYA)


Cat: CBMOAB-36140FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36140FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO36140FYA 100 µg
CBMOAB-66338FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66338FYA 100 µg
MO-AB-07557R Monoclonal Cattle (Bos taurus) WB, ELISA MO07557R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO36140FYA
SpecificityThis antibody binds to Rhesus ARHGAP15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ARHGAP15 Antibody is a mouse antibody against ARHGAP15. It can be used for ARHGAP15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRho GTPase-activating protein 15; ARHGAP15
UniProt IDH9F5X2
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: RVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFERFVEAIKKQDNNTRIEAVKCLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFSSEED.
For Research Use Only | Not For Clinical Use.
Online Inquiry