AibGenesis™ Mouse Anti-ARHGEF19 Antibody (CBMOAB-36205FYA)


Cat: CBMOAB-36205FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36205FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio) WB, ELISA MO36205FYA 100 µg
CBMOAB-66423FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66423FYA 100 µg
MO-AB-01562H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01562C 100 µg
MO-AB-14657W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14657W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Zebrafish (Danio rerio)
CloneMO36205FYA
SpecificityThis antibody binds to Rhesus ARHGEF19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ARHGEF19 Antibody is a mouse antibody against ARHGEF19. It can be used for ARHGEF19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARHGEF19
UniProt IDF7BQ90
Protein RefseqThe length of the protein is 186 amino acids long.
The sequence is show below: RFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTYQRLLLENPRFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLPAAPPAKLKLSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry