AibGenesis™ Mouse Anti-arl16 Antibody (CBMOAB-66509FYA)


Cat: CBMOAB-66509FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66509FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO66509FYA 100 µg
MO-AB-23026W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23026W 100 µg
MO-AB-24156H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24156C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO66509FYA
SpecificityThis antibody binds to Zebrafish arl16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). This protein has been shown to have an inhibitory role in the cellular antiviral response. This gene product interacts with the C-terminal domain of the DEXD/H-box helicase 58 (DDX58) gene product. This interaction was found to suppress the association between the DDX58 gene product and RNA, thereby negatively regulating the activity of the DDX58 gene product. (From NCBI)
Product OverviewMouse Anti-Zebrafish arl16 Antibody is a mouse antibody against arl16. It can be used for arl16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarl16; ADP Ribosylation Factor Like GTPase 16
UniProt IDF1QAH7
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: MCLLLGATGVGKTLLLKRLQKLCQMDPCADLGEAPVTLPTVGTNLTDLILKKKKKKITVRELGGCMGPIWPKYYLDCKSVIFVVDCVNVEQISSSCVQLLSVLSAESLLSAAVLILFNKRDLLCSMSLVELKSLFRMDDIIKSAPQFVTILEVSARSGQGLQDVLHWLSSNLSDTSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry