AibGenesis™ Mouse Anti-ARMC7 Antibody (CBMOAB-36280FYA)
Cat: CBMOAB-36280FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36280FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO36280FYA | 100 µg | ||
| CBMOAB-66560FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66560FYA | 100 µg | ||
| MO-AB-01596H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01596C | 100 µg | ||
| MO-AB-07610R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07610R | 100 µg | ||
| MO-AB-13191W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13191W | 100 µg | ||
| MO-AB-24177H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24177C | 100 µg | ||
| MO-AB-51306W | Monoclonal | Marmoset | WB, ELISA | MO51306W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO36280FYA |
| Specificity | This antibody binds to Rhesus ARMC7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus ARMC7 Antibody is a mouse antibody against ARMC7. It can be used for ARMC7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Armadillo repeat-containing protein 7; ARMC7 |
| UniProt ID | H9F3P3 |
| Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: PPGRSFPPELTAAPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSMAPRQR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry