AibGenesis™ Mouse Anti-ARMCX3 Antibody (MO-AB-18568W)


Cat: MO-AB-18568W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18568W Monoclonal Chimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset WB, ELISA MO18568W 100 µg
MO-AB-43725W Monoclonal Horse (Equus caballus) WB, ELISA MO43725W 100 µg
MO-AB-51311W Monoclonal Marmoset WB, ELISA MO51311W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Horse (Equus caballus), Marmoset
CloneMO18568W
SpecificityThis antibody binds to Chimpanzee ARMCX3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Chimpanzee ARMCX3 Antibody is a mouse antibody against ARMCX3. It can be used for ARMCX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArmadillo repeat containing, X-linked 3; ARMCX3
UniProt IDH2QYX1
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFRWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE.
For Research Use Only | Not For Clinical Use.
Online Inquiry