AibGenesis™ Mouse Anti-ARMCX6 Antibody (MO-AB-07615R)


Cat: MO-AB-07615R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07615R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO07615R 100 µg
MO-AB-18193W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18193W 100 µg
MO-AB-51312W Monoclonal Marmoset WB, ELISA MO51312W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO07615R
SpecificityThis antibody binds to Cattle ARMCX6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ARMCX6 Antibody is a mouse antibody against ARMCX6. It can be used for ARMCX6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArmadillo repeat containing, X-linked 6; ARMCX6
UniProt IDQ0VCV1
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: MGRAREVGWMAAGLMIGAGACYCVYKLTIGRDDSEKSEEEEEEWDDERELDDEEREIWFDLTTMARPWSEDGDWTEPGAPGGAEDRPSGGGKASRTYLVKQRPFPYEHKNTWSAQSFKNFCCALGLSKGPFIQGKMLLAEPKDASFSFSHDINSHLASLSIDGNTIPTPDPAVEEGKALYVPDNLNASVENQGQMKTCISQVCRETVSLCCNSFLQQAGLNLLISMTVIKNMLAKSVPGLMLPLIPEGSECAEGQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry