AibGenesis™ Mouse Anti-arrdc3 Antibody (MO-AB-01623H)


Cat: MO-AB-01623H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01623H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO01623C 100 µg
MO-AB-07643R Monoclonal Cattle (Bos taurus) WB, ELISA MO07643R 100 µg
MO-AB-26132W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26132W 100 µg
MO-AB-51344W Monoclonal Marmoset WB, ELISA MO51344W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO01623C
SpecificityThis antibody binds to Frog arrdc3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the arrestin family of proteins, which regulate G protein-mediated signaling. The encoded protein is thought to act as a regulator of breast cancer growth and progression by binding to a phosphorylated form of integrin beta4, a tumor-related antigen, targeting the integrin for internalization and degradation. (From NCBI)
Product OverviewThis product is a mouse antibody against arrdc3. It can be used for arrdc3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC131006 protein; arrdc3; MGC131006
UniProt IDQ32NN8
Protein RefseqThe length of the protein is 349 amino acids long.
The sequence is show below: MVLGKVKSLTISFDCLNGSHVPVYSSGDSVSGKVNVEVTGDIRVKSLRIHARGHAKVRWTESRNAGSNTAYTQNYTEEVDYFTHKHLLIGHERDDDNSEEGLTTIHSGRHEYAFSFELPQIPLATSFEGRHGSVRYWVKAELHRPWLLPVKLKKEFTVFEHIDINTPSLLAPQAGTKEKTLCCWLCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAALYQTQTFYAKGKMKEVKQLVANLRGESLSSGKTETWNGKLLKIPPVSPSIIDCSIIRVEYSLMVYVDIPGAMDLFLNLPLVIGTIPLHPFGSRTSSVSSQYSINNWLGLTLPERPEGKFVIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry