AibGenesis™ Mouse Anti-ARSJ Antibody (CBMOAB-36322FYA)


Cat: CBMOAB-36322FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36322FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo) WB, ELISA MO36322FYA 100 µg
MO-AB-13057W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13057W 100 µg
MO-AB-29043W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29043W 100 µg
MO-AB-34415W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34415W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo)
CloneMO36322FYA
SpecificityThis antibody binds to Rhesus ARSJ.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ARSJ Antibody is a mouse antibody against ARSJ. It can be used for ARSJ detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARSJ
UniProt IDF7HDJ5
Protein RefseqThe length of the protein is 514 amino acids long.
The sequence is show below: MAPRGCAGHPPPPSPQAWVCPGKMLAMGALAGFWILCLLTYGYLSWGQGLEEEEEGALLAQAGDRLEPSTTSTSQPHLIFILADDQGFRDVGYHGSEIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFITGKYQIHTGLQHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKECMPTKRGFDTFFGSLLGSGDYYTHYKCDSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAINNVTLALKTYGFYNNSIIIYSSDNGGQPTAGGSNWPLRGSKGTYWEGGIRAVGFVHSPLLKNKGTVCKELVHITDWYPTLISLAEGQIDEDIQLDGYDIWETISEGLRSPRVDILHNIPYTPRQKMAPGQQAMGSGTLQSSQPSECSTGNCSQEILATATGCPLSLSATWDRTGGTMNGLPCQLAKVYGFSTSQPTHMRGWTYLTGIQES.
For Research Use Only | Not For Clinical Use.
Online Inquiry