AibGenesis™ Mouse Anti-Arx Antibody (CBMOAB-01264FYA)


Cat: CBMOAB-01264FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01264FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO01264FYA 100 µg
CBMOAB-36329FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36329FYA 100 µg
CBMOAB-66648FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66648FYA 100 µg
MO-AB-00087R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00087R 100 µg
MO-AB-01632H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01632C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO01264FYA
SpecificityThis antibody binds to fruit fly Arx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Expansion of a polyalanine tract and other mutations in this gene cause X-linked cognitive disability and epilepsy. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Arx Antibody is a mouse antibody against Arx. It can be used for Arx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAsterix; LD18018p; arx
UniProt IDQ8SWX0
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MVYCPYNKEHKMLRKKLQQHILKCRVIYKDTVELMVCPFNSSHLIPEPQFFQHTQSCEDRNIIVHYQTSAPAVLSEDTRHAKIESEENWDDDESVPDYDPQVYCSRANIVREPNGLFPAQRRAFIEQEKRRHFGEDYEEEKKPRKAKARADLRPTPYEHRRPYSRRQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry