AibGenesis™ Mouse Anti-ascl1a Antibody (CBMOAB-66745FYA)


Cat: CBMOAB-66745FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66745FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66745FYA 100 µg
MO-DKB-00151W Polyclonal Zebrafish (Danio rerio) ELISA 100 µg
MO-DKB-03933W Polyclonal Zebrafish (Danio rerio) Pep-ELISA 100 µg
MO-MMB-0590 Polyclonal Zebrafish (Danio rerio) IA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66745FYA
SpecificityThis antibody binds to Zebrafish ascl1a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscriptional regulator. May mediate transcription activation by binding to the E box-containing promoter. Involved in neurogenesis. Required for the development of neurons in the epiphysis, acting partially redundantly with neurog1 and downstream of flh. Involved in maintaining rhombomere boundaries in the hindbrain, probably via up-regulation of delta expression. Also involved in pituitary development; required cell-autonomously in adenohypophyseal cells for endocrine differentiation and for survival of a subset of cells. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ascl1a Antibody is a mouse antibody against ascl1a. It can be used for ascl1a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAchaete-scute homolog 1a; Zash-1a; Pituitary-absent protein; ascl1a; ash ash1a asha pi
UniProt IDQ90259
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MDITAKMEISVNQQQFMPPACFFASQSIQLSPTDSQCSNKSASKQAKRQRSSSPELLRCKRRLNFAGFGYSLPQQQPHAVARRNERERNRVKLVNNGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQSGVLSPTISQNYSNDMNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF.
For Research Use Only | Not For Clinical Use.
Online Inquiry