AibGenesis™ Mouse Anti-AT2G31490 Antibody (CBMOAB-10631FYC)


Cat: CBMOAB-10631FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10631FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO10631FC 100 µg
Inquiry
MO-DKB-02082W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO10631FC
SpecificityThis antibody binds to Arabidopsis AT2G31490.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis AT2G31490 Antibody is a mouse antibody against AT2G31490. It can be used for AT2G31490 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT2G31490 protein; At2g31490; Expressed protein; Putative uncharacterized protein At2g31490; At2g31490
UniProt IDQ9SIQ8
Protein RefseqThe length of the protein is 71 amino acids long. The sequence is show below: MGGGMETNKNKFIEDWGSARENLEHNFRWTRRNFALIGIFGIALPIIVYKGIVKDFHMQDEDAGRPHRKFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry