AibGenesis™ Mouse Anti-atp5f1d Antibody (MO-AB-01719H)
Cat: MO-AB-01719H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01719H | Monoclonal | Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Rat (Rattus norvegicus) | WB, ELISA | MO01719C | 100 µg | ||
| MO-AB-07797R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07797R | 100 µg | ||
| MO-AB-20030W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20030W | 100 µg | ||
| MO-AB-24229H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24229C | 100 µg | ||
| MO-DKB-01223W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Rat (Rattus norvegicus) |
| Clone | MO01719C |
| Specificity | This antibody binds to Frog atp5f1d. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the delta subunit of the catalytic core. Alternatively spliced transcript variants encoding the same isoform have been identified. (From NCBI) |
| Product Overview | This product is a mouse antibody against atp5f1d. It can be used for atp5f1d detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MGC85306 protein; atp5d; MGC85306 |
| UniProt ID | Q66KY9 |
| Protein Refseq | The length of the protein is 162 amino acids long. The sequence is show below: MLSARALFALRRAVFSQVRTYAEAAPAGAPAMSFTFASSTQVFYSGASVKQVDVPTLTGMFGILPAHVPTLQVLRPGLVTVFSDDGVATKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLSTAKSNLEKAQAELQSAGDEAAKAEALINVEASEAIVKALE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry