AibGenesis™ Mouse Anti-ATP5L Antibody (CBMOAB-36574FYA)
Cat: CBMOAB-36574FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36574FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) | WB, ELISA | MO36574FYA | 100 µg | ||
| CBMOAB-67108FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67108FYA | 100 µg | ||
| MO-AB-07801R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07801R | 100 µg | ||
| MO-AB-10694Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10694Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss), Zebrafish (Danio rerio) |
| Clone | MO36574FYA |
| Specificity | This antibody binds to Rhesus ATP5L. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core, and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Rhesus ATP5L Antibody is a mouse antibody against ATP5L. It can be used for ATP5L detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP synthase subunit g, mitochondrial; ATP5L |
| UniProt ID | H9F4A0 |
| Protein Refseq | The length of the protein is 91 amino acids long. The sequence is show below: PALVNAAETYSKPRFATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry