AibGenesis™ Mouse Anti-ATP5O Antibody (CBMOAB-36575FYA)


Cat: CBMOAB-36575FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36575FYA Monoclonal Rhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO36575FYA 100 µg
CBMOAB-67109FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67109FYA 100 µg
MO-AB-07307Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07307Y 100 µg
MO-AB-14300Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14300Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO36575FYA
SpecificityThis antibody binds to Rhesus ATP5O.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP5O Antibody is a mouse antibody against ATP5O. It can be used for ATP5O detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit O, mitochondrial; ATP5O
UniProt IDH9FVY9
Protein RefseqThe length of the protein is 213 amino acids long.
The sequence is show below: MAAPGVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNAQGVVSAFSTMMSVHRGEVPCTVTTASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSIMGGMIVRIGEKYVDMSVKTKIQKLGRAMREAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry