AibGenesis™ Mouse Anti-atp5po Antibody (MO-AB-01730H)


Cat: MO-AB-01730H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01730H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO01730C 100 µg
MO-AB-07813R Monoclonal Cattle (Bos taurus) WB, ELISA MO07813R 100 µg
MO-AB-10844W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10844W 100 µg
MO-AB-24243H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24243C 100 µg
MO-DKB-01397W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO01730C
SpecificityThis antibody binds to Frog atp5po.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. (From NCBI)
Product OverviewThis product is a mouse antibody against atp5po. It can be used for atp5po detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC414601 protein; LOC414601
UniProt IDQ3KQC0
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MAAVGSFSVKVRSFSTSAVRPISRLVKPPIQVYGLEGRYATALYSAASKGKKLEQVEKELNRVSTLFKDPKLSGIVTNPHIKRALKQKTVGDILAKEKFSPLTVNFVNLLAENGRLSRASDVISSFAKIMSAHRGEVLCSVTTASPLDEANLTELKSALNGFLAKGETLQLETKTDVSILGGMIVSVGDKYIDMSTKAKIQKLTKIMKETV.
For Research Use Only | Not For Clinical Use.
Online Inquiry