AibGenesis™ Mouse Anti-atxn10 Antibody (CBMOAB-67215FYA)


Cat: CBMOAB-67215FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67215FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Primat, Rhesus (Macaca mulatta), Marmoset WB, ELISA MO67215FYA 100 µg
MO-AB-02255W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02255W 100 µg
MO-AB-07887R Monoclonal Cattle (Bos taurus) WB, ELISA MO07887R 100 µg
MO-AB-10921W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10921W 100 µg
MO-AB-43825W Monoclonal Horse (Equus caballus) WB, ELISA MO43825W 100 µg
MO-AB-51630W Monoclonal Marmoset WB, ELISA MO51630W 100 µg
MO-DKB-01261W Polyclonal Human (Homo sapiens), Primat, Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Human (Homo sapiens), Primat, Rhesus (Macaca mulatta), Marmoset
CloneMO67215FYA
SpecificityThis antibody binds to Zebrafish atxn10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that may function in neuron survival, neuron differentiation, and neuritogenesis. These roles may be carried out via activation of the mitogen-activated protein kinase cascade. Expansion of an ATTCT repeat from 9-32 copies to 800-4500 copies in an intronic region of this locus has been associated with spinocerebellar ataxia, type 10. Alternatively spliced transcript variants have been described. (From NCBI)
Product OverviewMouse Anti-Zebrafish atxn10 Antibody is a mouse antibody against atxn10. It can be used for atxn10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAtaxin 10; atxn1
UniProt IDB3DJT3
Protein RefseqThe length of the protein is 484 amino acids long.
The sequence is show below: MAGSGDSMQNINNTLSEITCEKLTNTHLEALQTLTSAFRDEQFRGSVDREVFGNLSAVLSRLSVDVQRLTDETESQEGEASSLCFKLTAECFRAHRNACVQCTQNQCSLRDLGSIKRSFEILSNLIKISSRGSNDIYDALRCGIQFLGNIAVGNQLCKDDIWEFGFPHIFWDILQLPDEKSISYTCMVIHTCLDEHKTEQFVEDTQRLKLTLKIMDLCRTLPDLDWTVFIVTQHFLKSTELIRKMYTEMTNEERLTLLELILAQLGVVEEQKDCLMPLSAAQFLASCFTDHGRTVLSLSSEASDNQAALVIIWLLDILCEMTSDRKEFMSLQDHPDLLSATVDLLKEIHLLGKNSRNVFTAAHNFTLTRPEGAETHPVLSFKAHLIRLIGNLCHGHVVNQDKVREMDGIALILDNCSIDSNNPFISQWAVFAIRNILEHNLENQKLIQGLRRQGLADDTMLRGMGFRVEERDGSLLLRPLKKDP.
For Research Use Only | Not For Clinical Use.
Online Inquiry