AibGenesis™ Mouse Anti-ATXN7L2 Antibody (CBMOAB-36646FYA)


Cat: CBMOAB-36646FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36646FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO36646FYA 100 µg
MO-AB-03412W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03412W 100 µg
MO-AB-07893R Monoclonal Cattle (Bos taurus) WB, ELISA MO07893R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO36646FYA
SpecificityThis antibody binds to Rhesus ATXN7L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATXN7L2 Antibody is a mouse antibody against ATXN7L2. It can be used for ATXN7L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAtaxin-7-like protein 2; ATXN7L2
UniProt IDH9F547
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: FRSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMWKKIPPAAEPPAHLVNSPLSAPLSPSSTGTCPRLPGPPPRPACPASTPPTKDSLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANTPSPSFSKLPPSKASKSSKGKDGVEVEAPSRKRKLSPGPTTLKRTCILEPTGKGKPSGCRGLSAKTKTALSMGLNGTMGPRVKRAGPLDCRGSPHQLPTPVKASQLENRGAAGHPAKALPTNCLSEEEVAKKRKNLATYCRPVKAKHCQAGAPADVACSVRRKKPGPALAFEEKCSTLKSKTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry