AibGenesis™ Mouse Anti-b4galt4 Antibody (CBMOAB-67341FYA)


Cat: CBMOAB-67341FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67341FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO67341FYA 100 µg
MO-AB-01790H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01790C 100 µg
MO-AB-07937R Monoclonal Cattle (Bos taurus) WB, ELISA MO07937R 100 µg
MO-AB-17650W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17650W 100 µg
MO-AB-24056R Monoclonal Pig (Sus scrofa) WB, ELISA MO24056R 100 µg
MO-AB-29202W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29202W 100 µg
MO-AB-42958W Monoclonal Hamsters (Cricetinae) WB, ELISA MO42958W 100 µg
MO-DKB-01409W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Dog (Canis lupus familiaris), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO67341FYA
SpecificityThis antibody binds to Zebrafish b4galt4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionResponsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish b4galt4 Antibody is a mouse antibody against b4galt4. It can be used for b4galt4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:101780; b4galt4; zgc:10178
UniProt IDQ5U3Q4
Protein RefseqThe length of the protein is 353 amino acids long.
The sequence is show below: MAVFSSMLKIIRKGKCLFLLLLCLCVVAWIATFSNDGPVKSVQEGSSPLDGQHAEGFHRLELESEMVQSIEERVEEPPTKESCPENSPLLRGSLKLTFEPSLTLEQVEIENAEVVEGQYKPSDCTARQSVAILIPHRNREKHLLYLLYHLHPFLQRQQLHYAIYVIHQAGVATFNRAKLLNVGYLEALKDYNWDCFIFHDVDLVPENDHNLYMCAKQPKHLVVGRNSTGYKLRYKGYFGGVSAMTKDQFHKVNGFPNSYWGWGGEDDDLRIRVQLQKMAIVRPPPEVARYTMVFHNRDSGNQVNKDRMQLLRRTHQTWKNDGLNSCSYKVMSVHRAPLYINVTVDIGQPEQAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry