Mouse Anti-BAG3 Antibody (CBMOAB-25039FYC)
Cat: CBMOAB-25039FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-25039FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO25039FC | 100 µg | ||
| CBMOAB-36742FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36742FYA | 100 µg | ||
| CBMOAB-67380FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67380FYA | 100 µg | ||
| MO-AB-23119W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23119W | 100 µg | ||
| MO-AB-07951R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07951R | 100 µg | ||
| MO-AB-24062R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24062R | 100 µg | ||
| MO-AB-01796H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01796C | 100 µg | ||
| MO-DKB-00780W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO25039FC |
| Specificity | This antibody binds to Arabidopsis BAG3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein encoded by this gene contains a WW domain in the N-terminal region and a BAG domain in the C-terminal region. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. |
| Product Overview | Mouse Anti-Arabidopsis BAG3 Antibody is a mouse antibody against BAG3. It can be used for BAG3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BCL2 Associated Athanogene 3; Bcl-2-Binding Protein Bis; Docking Protein CAIR-1; BAG-3; BIS; BAG Family Molecular Chaperone Regulator 3 |
| UniProt ID | Q9LYP4 |
| Protein Refseq | The length of the protein is 303 amino acids long. The sequence is show below: MMKMNTGTSPSVIGGGTSGNEWESRPGGMVVQRRTDQNSDVPRVFRVRVKYGSVYHEININSQSSFGELKKMLSDQVGLHHEDMKVLYKDKERDSKMFLDLCGVKDRSKLVVKEDPISQEKRLLAKRKNAAIEKASKSISDISFEVDRLAGQVSAFETVINKGGKVEEKSLVNLIEMLMNQLLRLDAIIADGDVKLMRKMQVQRVQKYVEALDLLKVKNSAKKVEVNKSVRHKPQTQTRFEQRDLLSFVEEEEEEPRNSNASSSSGTPAVVASKWEMFDSASTAKAAETVKPVPPRFKWEFFD. |
See other products for " BAG3 "
| MO-AB-51717W | Mouse Anti-BAG3 Antibody (MO-AB-51717W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry