AibGenesis™ Mouse Anti-BAIAP2L2 Antibody (CBMOAB-36757FYA)


Cat: CBMOAB-36757FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36757FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO36757FYA 100 µg
CBMOAB-67419FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67419FYA 100 µg
MO-AB-07957R Monoclonal Cattle (Bos taurus) WB, ELISA MO07957R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Zebrafish (Danio rerio)
CloneMO36757FYA
SpecificityThis antibody binds to Rhesus BAIAP2L2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene binds phosphoinositides and promotes the formation of planar or curved membrane structures. The encoded protein is found in RAB13-positive vesicles and at intercellular contacts with the plasma membrane. (From NCBI)
Product OverviewMouse Anti-Rhesus BAIAP2L2 Antibody is a mouse antibody against BAIAP2L2. It can be used for BAIAP2L2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBAIAP2L2
UniProt IDF6R1S4
Protein RefseqThe length of the protein is 529 amino acids long.
The sequence is show below: MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGERALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHMEKNTKLDMQFIKDSRQHYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEFSSPRSRHGSGSYGPEPSARPASQLEPDRRSLPRTPSASSLYSGSTQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPITPVTPMTSMSPMTPMMPVKPGNELPSRSYPLRGSHSLNDLLDRPGNSTAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRGSMGSTGTATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR.
For Research Use Only | Not For Clinical Use.
Online Inquiry