AibGenesis™ Mouse Anti-BANF2 Antibody (CBMOAB-36766FYA)


Cat: CBMOAB-36766FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36766FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO36766FYA 100 µg
MO-AB-07962R Monoclonal Cattle (Bos taurus) WB, ELISA MO07962R 100 µg
MO-AB-14702W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14702W 100 µg
MO-AB-24319H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24319C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO36766FYA
SpecificityThis antibody binds to Rhesus BANF2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BANF2 Antibody is a mouse antibody against BANF2. It can be used for BANF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBANF2
UniProt IDF7FMT7
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: MDHMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKTAYLCLTRPGIMHFNESEFQRWLICCCGATECEAQQSSNCLKEWCACFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry