AibGenesis™ Mouse Anti-barhl2 Antibody (CBMOAB-67443FYA)


Cat: CBMOAB-67443FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67443FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO67443FYA 100 µg
MO-AB-01804H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01804C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO67443FYA
SpecificityThis antibody binds to Zebrafish barhl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish barhl2 Antibody is a mouse antibody against barhl2. It can be used for barhl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBarH-class homeodomain transcription factor; barhl
UniProt IDQ6YI96
Protein RefseqThe length of the protein is 364 amino acids long.
The sequence is show below: MEGSSGASFGIDTILSTTNSGTSVLMNGDFRLGDSSRTADFRSQATPSPCSEIDTVGTAPSSPISVTMEHPEPHLVQDSLQHHHHHHHHSQAQSLQLSPQPHLLGQAGCAPRTATSSFLIKDILGDSKPLAACAPYSTSVPSPHHSPKTESGTAPDGIRPKLEQDENRSKLDKRDDIQSDLKCLNGTKEEGDREISSSRDSPPVRSKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSPYFYHPSLLGTVDSTTAAAAAAAMYSSMYRTPSTPHPSLQRPLVPRVLIHGLGPGGQPALNPIPNPIPGTPHAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry