Mouse Anti-Barrel medic RBP1 Antibody (MO-AB-00533W)


Cat: MO-AB-00533W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula)
CloneMO00533W
SpecificityThis antibody binds to Barrel medic RBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Barrel medic RBP1 Antibody is a mouse antibody against RBP1. It can be used for RBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA recognition motif; RNA-binding protein; RNA-binding protein with multiple splicing; rbp1; MTR_6g034835
UniProt IDQ8H0P8
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MADGYWNRQQSLLPHSGLHKRPRPDYEMPASGLPSGNEMHYLSREEDRSGHPMVKDSKTIGSAYDRYLQGQVPSFTSGEASTVGALGLQRGIGGLPNHSLSDPSAMIGRHGGGGPDLAPNGRGMNYGFQPPMDPVSRHGPEPALLPPDASPTLYIEGLPSDCTRREVAHIFRPFVGYREVRLVSKEAKHRGDPLILCFVDFANPACAATALSALQGYKVDEINPESSHLRLQFSRYPGPRSGGGPRSSGPPRGGHGSRGRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry