Mouse Anti-Rat Rbp1 Antibody (MO-AB-28380H)


Cat: MO-AB-28380H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO28380C
SpecificityThis antibody binds to Rat Rbp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against Rbp1. It can be used for Rbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinol-binding protein 1; Cellular retinol-binding protein; CRBP; Cellular retinol-binding protein I; CRBP-I; Rbp1; Rbp-1
UniProt IDP02696
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: MPVDFNGYWKMLSNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRAEGVTCKQVFKKVH.
For Research Use Only | Not For Clinical Use.
Online Inquiry