AibGenesis™ Mouse Anti-bbip1 Antibody (CBMOAB-67485FYA)
Cat: CBMOAB-67485FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-67485FYA | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO67485FYA | 100 µg | ||
| MO-AB-15460W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15460W | 100 µg | ||
| MO-AB-51759W | Monoclonal | Marmoset | WB, ELISA | MO51759W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO67485FYA |
| Specificity | This antibody binds to Zebrafish bbip1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of eight proteins that form the BBSome complex and is essential for its assembly. The BBSome complex is involved in trafficking signal receptors to and from the cilia. Mutations in this gene result in Bardet-Biedl syndrome 18. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish bbip1 Antibody is a mouse antibody against bbip1. It can be used for bbip1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BBSome-interacting protein 1; BBSome-interacting protein of 10 kDa; bbip1; bbip1 |
| UniProt ID | Q1L8Y6 |
| Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: MPEVKSMFREVLPKQGQLSMEDVPTMVLCKPKLLPLKSVTLEKLEKMQKDAQEIIRQQELALKEQPPSEKAE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry